WDR49 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-WDR49 antibody: synthetic peptide directed towards the C terminal of human WDR49. Synthetic peptide located within the following region: ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	WD repeat domain 49
Database Link	NP_849146 Entrez Gene 151790 Human
Background	WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown.
Synonyms	FLJ33620
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.