DHFRL1 (DHFR2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DHFRL1 antibody: synthetic peptide directed towards the middle region of human DHFRL1. Synthetic peptide located within the following region: RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	dihydrofolate reductase like 1
Database Link	NP_789785 Entrez Gene 200895 Human UniProt ID Q86XF0
Background	DHFRL1 may play a role in folate metabolism.
Synonyms	DHFRP4
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.