ODF3L1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ODF3L1 antibody: synthetic peptide directed towards the N terminal of human ODF3L1. Synthetic peptide located within the following region: KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	outer dense fiber of sperm tails 3 like 1
Database Link	NP_787077 Entrez Gene 161753 Human UniProt ID Q8IXM7
Background	The exact function of ODF3L1 remains unknown.
Synonyms	MGC48986
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Rat: 80%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.