RAB3IP Rabbit Polyclonal Antibody
CAT#: TA337554
Rabbit Polyclonal Anti-RAB3IP Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
Specifications
Product Data | |
Applications | IF, WB |
Recommend Dilution | WB, IF |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB3IP antibody: synthetic peptide directed towards the N terminal of human RAB3IP. Synthetic peptide located within the following region: APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | RAB3A interacting protein |
Database Link | |
Background | The specific function of this protein remains unknown. |
Synonyms | RABIN3; RABIN8 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |