PLEKHA7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLEKHA7 antibody: synthetic peptide directed towards the middle region of human PLEKHA7. Synthetic peptide located within the following region: PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	127 kDa
Gene Name	pleckstrin homology domain containing A7
Database Link	NP_778228 Entrez Gene 144100 Human UniProt ID Q6IQ23
Background	PLEKHA7 is required for zonula adherens biogenesis and maintenance.PLEKHA7 acts via its interaction with KIAA1543/Nezha, which anchors microtubules at their minus-ends to zonula adherens, leading to recruit KIFC3 kinesin to junctional site.
Synonyms	DKFZp686M22243
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.