CEP27 (HAUS2) Rabbit Polyclonal Antibody
CAT#: TA337336
Rabbit Polyclonal Anti-HAUS2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-HAUS2 antibody is: synthetic peptide directed towards the C-terminal region of Human HAUS2. Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | HAUS augmin like complex subunit 2 |
Database Link | |
Background | HAUS2 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly. |
Synonyms | C15orf25; CEP27; HsT17025 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rabbit: 86%; Guinea pig: 82%; Dog: 79%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |