GRRP1 (FAM110D) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM110D antibody is: synthetic peptide directed towards the N-terminal region of Human FAM110D. Synthetic peptide located within the following region: PPSTPSRGRTPSAVERLEADKAKYVKTHQVIARRQEPALRGSPGPLTPHP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	family with sequence similarity 110 member D
Database Link	NP_079145 Entrez Gene 79927 Human UniProt ID Q8TAY7
Background	The function of this protein remains unknown.
Synonyms	GRRP1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.