TIP120A (CAND1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CAND1 antibody: synthetic peptide directed towards the middle region of human CAND1. Synthetic peptide located within the following region: AALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	136 kDa
Gene Name	cullin associated and neddylation dissociated 1
Database Link	NP_060918 Entrez Gene 71902 MouseEntrez Gene 55832 Human UniProt ID Q86VP6
Background	CAND1 enhances transcription from various types of promoters. It is a regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. CAND1 prevents neddylation of CUL1 by physically blocking access to the neddylation site. CAND1 disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins.
Synonyms	TIP120; TIP120A
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.