KLHL26 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Klhl26 antibody is synthetic peptide directed towards the N-terminal region of Mouse Klhl26. Synthetic peptide located within the following region: GQLLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	kelch like family member 26
Database Link	NP_060786 Entrez Gene 234378 Mouse UniProt ID Q53HC5
Background	The function of this protein remains unknown.
Synonyms	FLJ11078
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.