FAM13C1 (FAM13C) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM13C1 Antibody: synthetic peptide directed towards the N terminal of human FAM13C1. Synthetic peptide located within the following region: RPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	family with sequence similarity 13 member C
Database Link	NP_001001971 Entrez Gene 220965 Human UniProt ID Q8NE31
Background	The function of FAM13C1 remians unknown.
Synonyms	FAM13C1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.