GRK4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	G protein-coupled receptor kinase 4
Database Link	NP_001004056 Entrez Gene 2868 Human UniProt ID P32298
Background	This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.
Synonyms	GPRK2L; GPRK4; GRK4a; IT11
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Zebrafish: 91%; Mouse: 86%; Bovine: 77%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Chemokine signaling pathway, Endocytosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.