GRK4 Rabbit Polyclonal Antibody

CAT#: TA336189

Rabbit Polyclonal Anti-GRK4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 59 kDa
Gene Name G protein-coupled receptor kinase 4
Background GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.
Synonyms GPRK2L; GPRK4; GRK4a; IT11
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Zebrafish: 86%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Chemokine signaling pathway, Endocytosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...