ANO9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ANO9 Antibody is: synthetic peptide directed towards the middle region of Human ANO9. Synthetic peptide located within the following region: AIIMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	anoctamin 9
Database Link	NP_001012302 Entrez Gene 338440 Human UniProt ID A1A5B4
Background	ANO9 does not exhibit calcium-activated chloride channel (CaCC) activity. It can inhibit the activity of ANO1.
Synonyms	PIG5; TMEM16J; TP53I5
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.