VSIG8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-VSIG8 Antibody: synthetic peptide directed towards the N terminal of human VSIG8. Synthetic peptide located within the following region: HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	V-set and immunoglobulin domain containing 8
Database Link	NP_001013683 Entrez Gene 391123 Human UniProt ID P0DPA2
Background	VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.
Synonyms	OTTHUMP00000033460; V-set and immunoglobulin domain containing 8
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.