IFITM5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IFITM5 Antibody: synthetic peptide directed towards the middle region of human IFITM5. Synthetic peptide located within the following region: AKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	interferon induced transmembrane protein 5
Database Link	NP_001020466 Entrez Gene 387733 Human UniProt ID A6NNB3
Background	IFITM5 plays a role in bone mineralization.
Synonyms	BRIL; DSPA1; fragilis4; Hrmp1; OI5
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Mouse: 92%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.