LAP2 (TMPO) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	thymopoietin
Database Link	NP_001027455 Entrez Gene 7112 Human UniProt ID P42166
Background	TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.
Synonyms	CMD1T; LAP2; LEMD4; PRO0868; TP
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 86%
Reference Data
Protein Families	Stem cell - Pluripotency, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.