ENTPD8 Rabbit Polyclonal Antibody
CAT#: TA336025
Rabbit Polyclonal Anti-ENTPD8 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ENTPD8 Antibody: synthetic peptide directed towards the N terminal of human ENTPD8. Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | ectonucleoside triphosphate diphosphohydrolase 8 |
Database Link | |
Background | ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP. |
Synonyms | E-NTPDase; GLSR2492; NTPDase-8; UNQ2492 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Purine metabolism, Pyrimidine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |