ENTPD8 Rabbit Polyclonal Antibody

CAT#: TA336025

Rabbit Polyclonal Anti-ENTPD8 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-ENTPD8 Antibody: synthetic peptide directed towards the N terminal of human ENTPD8. Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 54 kDa
Gene Name ectonucleoside triphosphate diphosphohydrolase 8
Background ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.
Synonyms E-NTPDase; GLSR2492; NTPDase-8; UNQ2492
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Bovine: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Purine metabolism, Pyrimidine metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...