GALNTL6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GALNTL6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GALNTL6. Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	polypeptide N-acetylgalactosaminyltransferase-like 6
Database Link	NP_001030017 Entrez Gene 442117 Human UniProt ID Q49A17
Background	GALNTL6 catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
Synonyms	GalNAc-T6L; GALNACT20; GALNT17
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Zebrafish: 93%; Horse: 83%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, O-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.