ARL17B Rabbit Polyclonal Antibody
CAT#: TA336004
Rabbit Polyclonal Anti-ARL17 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ARL17 Antibody: synthetic peptide directed towards the middle region of human ARL17. Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 19 kDa |
Gene Name | ADP ribosylation factor like GTPase 17B |
Database Link | |
Background | ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. |
Synonyms | ARL17; ARL17A |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |