CEACAM16 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CEACAM16 Antibody: synthetic peptide directed towards the middle region of human CEACAM16. Synthetic peptide located within the following region: LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	carcinoembryonic antigen related cell adhesion molecule 16
Database Link	NP_001034302 Entrez Gene 388551 Human UniProt ID Q2WEN9
Background	CEACAM16 belongs to the immunoglobulin superfamily, CEA family.
Synonyms	CEAL2; DFNA4B
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Rabbit: 92%; Horse: 91%; Bovine: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.