ACBD7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ACBD7 Antibody: synthetic peptide directed towards the N terminal of human ACBD7. Synthetic peptide located within the following region: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	10 kDa
Gene Name	acyl-CoA binding domain containing 7
Database Link	NP_001034933 Entrez Gene 414149 Human UniProt ID Q8N6N7
Background	The function of this protein remains unknown.
Synonyms	bA455B2.2
Note	Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Bovine: 86%; Pig: 85%; Rabbit: 85%; Guinea pig: 85%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.