Kallikrein 5 (KLK5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KLK5 Antibody: synthetic peptide directed towards the N terminal of human KLK5. Synthetic peptide located within the following region: CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	kallikrein related peptidase 5
Database Link	NP_001070959 Entrez Gene 25818 Human UniProt ID Q9Y337
Background	Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one
Synonyms	KLK-L2; KLKL2; SCTE
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.