FAM55D (NXPE4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Fam55d Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NSDVERFSDFHGYTQYLALKDIFQDLNVGVIDAWDMTVAYGINNVHPPED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	neurexophilin and PC-esterase domain family member 4
Database Link	NP_001071107 Entrez Gene 244853 Mouse UniProt ID Q6UWF7
Background	The function of this protein remains unknown.
Synonyms	C11orf33; FAM55D
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 85%; Mouse: 85%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.