Paox Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Paox Antibody is: synthetic peptide directed towards the middle region of Rat Paox. Synthetic peptide located within the following region: FQLAAEFGLLGEKELSEENQLVETGGHVALPSVSCTSSGTSVSLELVTEM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	polyamine oxidase (exo-N4-amino)
Database Link	NP_001099781 Entrez Gene 293589 Rat
Background	The function of this protein remains unknown.
Synonyms	DKFZp434J245; MGC45464; PAO
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 92%; Rat: 86%; Mouse: 86%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.