CPSF4L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CPSF4L Antibody is: synthetic peptide directed towards the N-terminal region of Human CPSF4L. Synthetic peptide located within the following region: EKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	cleavage and polyadenylation specific factor 4-like
Database Link	NP_001123357 Entrez Gene 642843 Human UniProt ID A6NMK7
Background	The function of this protein remains unknown.
Synonyms	0610010C04Rik; 1500000C01Rik; cleavage and polyadenylation specific factor 4-like; D11Ertd636e; OTTMUSP00000004107; OTTMUSP00000004108
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 82%; Rat: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.