Cip4 (TRIP10) Rabbit Polyclonal Antibody
CAT#: TA335756
Rabbit Polyclonal Anti-TRIP10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: ENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 63 kDa |
Gene Name | thyroid hormone receptor interactor 10 |
Database Link | |
Background | TRIP10 is in FNBP1 family of proteins. |
Synonyms | CIP4; HSTP; STOT; STP; TRIP-10 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Insulin signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |