CIAO1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CIAO1 Antibody: synthetic peptide directed towards the middle region of human CIAO1. Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	cytosolic iron-sulfur assembly component 1
Database Link	NP_004795 Entrez Gene 9391 Human UniProt ID O76071
Background	CIAO1 belongs to the WD repeat CIA1 family. It seems to specifically modulate the transactivation activity of WT1.
Synonyms	CIA1; WDR39
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Yeast: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.