CIAO1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-WDR39 Antibody: synthetic peptide directed towards the C terminal of human WDR39. Synthetic peptide located within the following region: LSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	cytosolic iron-sulfur assembly component 1
Database Link	NP_004795 Entrez Gene 9391 Human UniProt ID O76071
Background	WDR39 is a member of the WD40 family of proteins. WDR39 specifically interacts with WT1 both in vitro and in vivo. This interaction results in a decrease in transcriptional activation mediated by WT1. WDR39 does not inhibit binding of WT1 to its consensus nucleotide sequence and does not affect the repression activity of WT1. Thus, WDR39 appears to specifically modulate the transactivation activity of WT1 and may function to regulate the physiological functions of WT1 in cell growth and differentiation.
Synonyms	CIA1; WDR39
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.