Chromosome X open reading frame 6 (MAMLD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CXorf6 Antibody: synthetic peptide directed towards the N terminal of human CXorf6. Synthetic peptide located within the following region: SPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	mastermind like domain containing 1
Database Link	NP_005482 Entrez Gene 10046 Human UniProt ID Q13495
Background	CXorf6 transactivates the HES3 promoter independently of NOTCH proteins. HES3 is a non-canonical NOTCH target gene which lacks binding sites for RBPJ.
Synonyms	CG1; CXorf6; F18; HYSP2
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.