FAM32A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM32A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM32A. Synthetic peptide located within the following region: DKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	12 kDa
Gene Name	family with sequence similarity 32 member A
Database Link	NP_054796 Entrez Gene 26017 Human UniProt ID Q9Y421
Background	Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. FAM32A may also increase cell sensitivity to apoptotic stimuli.
Synonyms	OTAG-12; OTAG12
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.