DC2L1 (DYNC2LI1) Rabbit Polyclonal Antibody
CAT#: TA335575
Rabbit Polyclonal Anti-DYNC2LI1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DYNC2LI1 Antibody is: synthetic peptide directed towards the C-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: EKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | dynein cytoplasmic 2 light intermediate chain 1 |
Database Link | |
Background | DYNC2LI1 may function as a motor for intraflagellar retrograde transport and functions in cilia biogenesis. |
Synonyms | CGI-60; D2LIC; LIC3; SRTD15 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rat: 92%; Rabbit: 86%; Mouse: 85%; Pig: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |