KLHL7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KLHL7 Antibody: synthetic peptide directed towards the middle region of human KLHL7. Synthetic peptide located within the following region: AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	kelch like family member 7
Database Link	NP_061334 Entrez Gene 55975 Human UniProt ID Q8IXQ5
Background	Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.
Synonyms	CISS3; KLHL6; SBBI26
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.