DUS3L Rabbit Polyclonal Antibody
CAT#: TA335502
Rabbit Polyclonal Anti-DUS3L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DUS3L Antibody is: synthetic peptide directed towards the N-terminal region of Human DUS3L. Synthetic peptide located within the following region: FLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | dihydrouridine synthase 3 like |
Database Link | |
Background | DUS3L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs. |
Synonyms | DUS3 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |