GIMAP6 Rabbit Polyclonal Antibody
CAT#: TA335463
Rabbit Polyclonal Anti-GIMAP6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GIMAP6 Antibody: synthetic peptide directed towards the C terminal of human GIMAP6. Synthetic peptide located within the following region: GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | GTPase, IMAP family member 6 |
Database Link | |
Background | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene. |
Synonyms | IAN-2; IAN-6; IAN2; IAN6 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |