CLMN Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CLMN Antibody: synthetic peptide directed towards the C terminal of human CLMN. Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	110 kDa
Gene Name	calmin (calponin-like, transmembrane)
Database Link	NP_079010 Entrez Gene 79789 Human UniProt ID Q96JQ2
Background	CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.
Synonyms	FLJ12383; FLJ43048; KIAA0500; KIAA1188
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 92%; Pig: 85%; Dog: 77%; Mouse: 77%; Bovine: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.