Asrgl1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Asrgl1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	asparaginase like 1
Database Link	NP_079886 Entrez Gene 66514 Mouse UniProt ID Q8C0M9
Background	Asrgl1 acts in asparagine catabolism. Asrgl1 may be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.
Synonyms	ALP; ALP1; CRASH; FLJ22316
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rabbit: 86%; Horse: 85%; Pig: 80%; Guinea pig: 80%; Rat: 79%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.