ARHGAP28 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARHGAP28 Antibody: synthetic peptide directed towards the C terminal of human ARHGAP28. Synthetic peptide located within the following region: AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	Rho GTPase activating protein 28
Database Link	NP_109597 Entrez Gene 79822 Human
Background	ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Synonyms	DKFZp686A2038; FLJ10312; Rho GTPase activating protein 28
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.