Spa17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Spa17 Antibody is: synthetic peptide directed towards the middle region of Rat Spa17. Synthetic peptide located within the following region: AYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	sperm autoantigenic protein 17
Database Link	NP_445934 Entrez Gene 85244 Rat
Background	Spa17 is a component of sperm acrosome; Spa17 binds A-kinase anchoring protein 3 (Akap3) and is thought to be involved in fertilization by binding to the zona pellucida of the oocyte?
Synonyms	CT22; SP17; SP17-1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 93%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.