ZNF498 (ZSCAN25) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF498 Antibody: synthetic peptide directed towards the middle region of human ZNF498. Synthetic peptide located within the following region: QIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	zinc finger and SCAN domain containing 25
Database Link	NP_660090 Entrez Gene 221785 Human UniProt ID Q6NSZ9
Background	The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determinedThis gene encodes a protein of unknown function. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions.
Synonyms	ZNF498
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.