TRIM35 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Trim35 Antibody is: synthetic peptide directed towards the middle region of MOUSE Trim35. Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	tripartite motif containing 35
Database Link	NP_741983 Entrez Gene 66854 Mouse UniProt ID Q9UPQ4
Background	Trim35 may play a role as a tumor suppressor. It implicated in the cell death mechanism.
Synonyms	HLS5; MAIR
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.