TRIM50 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TRIM50 Antibody: synthetic peptide directed towards the middle region of human TRIM50. Synthetic peptide located within the following region: DWRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	tripartite motif containing 50
Database Link	NP_835226 Entrez Gene 135892 Human UniProt ID Q86XT4
Background	TRIM50 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. TRIM50 is an E3 ubiquitin-protein ligase.
Synonyms	TRIM50A
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.