ENPP7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the middle region of Human ENPP7. Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	ectonucleotide pyrophosphatase/phosphodiesterase 7
Database Link	NP_848638 Entrez Gene 339221 Human UniProt ID Q6UWV6
Background	ENPP7 converts sphingomyelin to ceramide. It also has phospholipase C activity toward palmitoyl lyso-phosphocholine and does not appear to have nucleotide pyrophosphatase activity.
Synonyms	339221; ALK-SMase; E-NPP 7; NPP-7; NPP7
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 86%; Zebrafish: 86%; Pig: 79%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Pathways	Metabolic pathways, Sphingolipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.