FAM194B (ERICH6B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM194B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM194B. Synthetic peptide located within the following region: LKKNYEKFKETILRIKRRREAQKLTEMTSFTFHLMSKPTPEKPETEEIQK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	glutamate rich 6B
Database Link	NP_872348 Entrez Gene 220081 Human UniProt ID Q5W0A0
Background	The function of this protein remains unknown.
Synonyms	FAM194B
Note	Immunogen Sequence Homology: Human: 100%; Goat: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.