FAM86A (EEF2KMT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Rat, Dog, Cow, Guinea Pig, Horse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	eukaryotic elongation factor 2 lysine methyltransferase
Database Link	NP_963892 Entrez Gene 302931 RatEntrez Gene 100855633 DogEntrez Gene 196483 Human UniProt ID Q96G04
Background	The function of this protein remains unknown.
Synonyms	eEF2-KMT; FAM86A; SB153
Note	Immunogen Sequence Homology: Human: 100%; Rat: 86%; Dog: 82%; Pig: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.