FAM83A Rabbit Polyclonal Antibody
CAT#: TA335330
Rabbit Polyclonal Anti-FAM83A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FAM83A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM83A. Synthetic peptide located within the following region: ANGRLSSSSGSASDRTSSNPFSGRSAGSHPVPESKQNKTKTKKQTTLWFL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | family with sequence similarity 83 member A |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | BJ-TSA-9 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
FAM83A Promotes Lung Cancer Progression by Regulating the Wnt and Hippo Signaling Pathways and Indicates Poor Prognosis
,Zheng, YW;Li, ZH;Lei, L;Liu, CC;Wang, Z;Fei, LR;Yang, MQ;Huang, WJ;Xu, HT;,
Front Oncol
,PubMed ID 32195172
[FAM83A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |