ONECUT3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ONECUT3 Antibody: synthetic peptide directed towards the C terminal of human LOC390874. Synthetic peptide located within the following region: ETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQRLVFTD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	one cut homeobox 3
Database Link	NP_001073957 Entrez Gene 390874 Human UniProt ID O60422
Background	ONECUT3 is a new protein with unknown function.
Synonyms	OC3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.