HLF Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HLF antibody: synthetic peptide directed towards the C terminal of human HLF. Synthetic peptide located within the following region: NNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	HLF, PAR bZIP transcription factor
Database Link	NP_002117 Entrez Gene 3131 Human UniProt ID Q16534
Background	HLF binds DNA specifically as homodimer or heterodimer with other PAR factors.
Synonyms	MGC33822
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.