AFF2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AFF2 antibody: synthetic peptide directed towards the middle region of human AFF2. Synthetic peptide located within the following region: AMGNCNNGPVTIPQRIHHMAASHVNITSNVLRGYEHWDMADKLTRENKEF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	145 kDa
Gene Name	AF4/FMR2 family member 2
Database Link	NP_002016 Entrez Gene 2334 Human UniProt ID P51816
Background	AFF2 belongs to the AF4 family. Defects in AFF2 are the cause of FRAXE. The exact function of AFF2 remains unknown.
Synonyms	FMR2; FMR2P; FRAXE; MRX2; OX19
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.