CFHL2 (CFHR2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CFHR2 antibody is: synthetic peptide directed towards the C-terminal region of Human CFHR2. Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	complement factor H related 2
Database Link	NP_005657 Entrez Gene 3080 Human UniProt ID P36980
Background	CFHR2 might be involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.
Synonyms	CFHL2; FHR2; HFL3
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 82%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.