PPM1J Rabbit Polyclonal Antibody
CAT#: TA335086
Rabbit Polyclonal Anti-PPM1J Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PPM1J antibody: synthetic peptide directed towards the C terminal of human PPM1J. Synthetic peptide located within the following region: YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | protein phosphatase, Mg2+/Mn2+ dependent 1J |
Database Link | |
Background | PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known. |
Synonyms | PP2CZ; PP2Czeta; PPP2CZ |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85% |
Reference Data | |
Protein Families | Phosphatase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |